LoginSign Up
← Back to all sparks
A

AccuRanker

MARKETING
Velocity6.3

AccuRanker unifies its filtering engine and bolts AI visibility onto a rank-tracking core.

seoai-visibilitymcpfilteringrank-tracking
◆Current state
AccuRanker is in a consolidation-plus-AI phase. The headline release rebuilds filtering so the filter bar, dynamic tags, saved segments, and the API all run on one shared engine — a foundational cleanup. Around it, the product is layering AI features (AccuLLM prompt suggestions, an MCP server for ChatGPT/Claude) and quality-of-life upgrades to the Tag Cloud (bulk actions, cross-domain sharing, prompt importing).
◆Where it's heading
The direction is clear: take a mature rank-tracker and re-platform it around two axes — a single consistent data/filtering layer underneath, and an AI/LLM-visibility layer on top that tracks how brands show up inside AI answers, not just classic SERPs. Tag Cloud work suggests prompts and tags are becoming first-class managed objects alongside keywords.
◆Prediction
Expect AI visibility and prompt management to keep absorbing roadmap weight, with the unified filtering engine becoming the substrate those features query against.

◆Recent moves

  1. 15d ago

    Title contains keyword, Landing page title and Prompt response text filters

  2. 15d ago

    A new unified filtering experience

    Filter bar, dynamic tags, saved segments, and the API now share one filtering engine, giving consistent results across the app — the kind of foundational re-platforming that makes later AI and tag features easier to build.

  3. 22d ago

    Improved Prompt Suggestions

    AccuLLM's auto-generated brand description, categories, and prompt suggestions become editable and re-triggerable, turning a one-shot generation into a reviewable workflow within the AI-visibility push.

  4. 1mo ago

    Introducing AccuRanker MCP

    ⚡ SPARK

    An MCP server lets users query their rankings, Share of Voice, and AI-visibility data directly from ChatGPT or Claude — extending AccuRanker from a dashboard you visit to a data source agents pull from.

  5. 1mo ago

    Bulk Actions in the Tag Cloud

    Bulk select, delete, and move across tags and folders in the Tag Cloud cuts the click cost of maintaining large tag structures — incremental but real for heavy users.

  6. 1mo ago

    Share Tag Cloud across Domains

    Tag Cloud structures — folders, dynamic tags and all — can now be shared onto other domains in one action, removing manual rebuilds and treating tag taxonomies as reusable assets.